Query Sequence
>BWI76_RS04370
MKSIPCVLMRGGTSKGAFLLADDLPKDIQKRDDCLLAIMGSGHELEIDGIGGGSPQTSKVAIISQSLSEEADIDYLFVQVIVNERRVDTTPNCGNMLCAVGGFAIEHGLVEAASPVTRVRIRNVNTNTFIDADVQTPDGKVIYEGDSQIDGVPGRAAPVALTFLNAAGAKSGRLFPTGNRMDVFDDVRVTCIDMAMPMVVIPAQSLGKTGYESASELDRDSGLLKSLESIRIQAGKAMGFGDVTNMVIPKPVLISPALSGGSINVRYFMPHNCHKSLAITGAIGLASACIIPKTIANELTKLSGDGIIKVEHPSGGIEVDLSQTTERPEDIRASVIRTARKILSGTVYIPE
Hit FamilyNo hits found for this sequence


back to search