Query Sequence
>BWI76_RS03970
MTTKMISEETLRPQEQEETRITPRDLRRVFWRSFQMEFSWNYERQMNLAFVYALIPVLKKLYPRKEELAAALKRHLVFFNTTPHIVTLLLGITTAMEEKNSQQKNMDANAIDNVKASLMGPLAGLGDSFFWGTLRLIATGIGTSLALKGNILGPILFLLVFNVPHILVRWFFTRWGYVLGTGVLQRIQKSGMMESLTYGASIIGLMVVGAMTASMIDITIPVSFGAGEAKTQVQDIINDILPCMLPLLSFGIVYWLLGRKVKPLSIIGGMALVGILGSWIGLF
Hit FamilyFIG00000924
Hit Family FunctionPTS system, mannose-specific IID component


back to search