Query Sequence
>BWI76_RS03870
MRRARIEWQGQRHDVQVNERGQVKLANGSLLKEGEFRWLPPANGTLFALGLNYADHASELAFTPPTEPLVFIKAPNTFIGHRQESVRPDNVEYMHYEAELVVVIGKTARKVAEADAMAYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDTLTPIGPWIVGKEAIPDPHNLALCTWVNGELRQQGTTADLIFSIPFLIAYLSEFMTLQPGDMIATGTPKGLSDVVPGDEVIVEVEGVGRLVNHIISQQAYEEKLS
Hit FamilyFIG00010241
Hit Family Function5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-)


back to search