Query Sequence
>BWI76_RS02795
MWKRLLLVTAVSAAMSSMVMAAPLTVGFSQVGSESGWRAAETNVAKEEAAKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWEPVLKEAKEAKIPVFLLDRSIDVKDKDLYMTTVTANNVLEGQLIGKWLVKTVDGKPCNVVELQGTVGASVAIDRKKGFAEAISKASNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMMAGEANASVELTPNMAGPAFDALEKYKKDGTLPEKVTITKSTLYLPDTAKEELEKKKNMGY
Hit FamilyFIG00003841
Hit Family FunctionPutative sugar ABC transport system, periplasmic binding protein YtfQ precursor


back to search