Query Sequence
>BWI76_RS02175
MKRIAIGCDHVGFILKDDIVLHLRQRGMEVVDKGAWSTERTDYPRYASAVAQAVAAGEVDGGILICGTGVGISIAANKHPGIRAVVCSEPYSAQLSRQHNDTNVLAFGARVIGLELAKMIVDAWLSAEFEGGRHQGRVDAIGAIEQQRI
Hit FamilyFIG00006469
Hit Family FunctionD-allose-6-phosphate isomerase (EC 5.3.1.-) / Ribose 5-phosphate isomerase B (EC 5.3.1.6)


back to search