Query Sequence
>BWI76_RS02090
MNDQICQRIENSAHFKELVAARQRFAAILSLIMLVIYVGFILLIAFAPGWLGTPLHAGTSVTRGIPIGIGVIVISFVLTGIYVWRANGEFDRLTKSILSEVKAS
Hit FamilyFIG00001462
Hit Family FunctionPutative membrane protein, clustering with ActP


back to search