Query Sequence
>BWI76_RS01745
MNTWLNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPTDISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVADFVCYLLSERASYMTGVTTNIAGGKTRG
Hit FamilyFIG01306640
Hit Family FunctionSorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)


back to search