Query Sequence
>BPHYT_RS33300
MVLELERVTVVSGAQTHLYGVDLRLVPGAINVLLGPTQAGKTTLMRVMAGLDRPASGRVLADGNDVTGVSVRQRNLAMVYQQFINYPAMTVFDNIASPLNLQKTPADEVKRRVHEVAAKLHIDHLLQRRPGELSGGQQQRCALARALVKRSSLVLLDEPLVNLDYKLREELRVELATLFADGKTTVVYATTEPLEALLLGGYTAIVDKGCVLQHGPTLDVYNAPANIDVAAVFNDPPMNMLASDLTADGTARLPIGIDVPLGRASARAVRENETFRIGVRPGHLRLAPRTPRSVAVPCRLELAELSGSETYLHLHTRQGGIDLVAQLQGVHQIDLGTELDVYIDPDELFVFGADTTLVSGPEAAHGAH
Hit FamilyFIG00027233
Hit Family FunctionGlycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)


back to search