Query Sequence
>BPHYT_RS31695
MSKNRDRKSLRSRAWFNNSDNPAMTALYLERFMNYGLTLEELKSERPVIGIAQTGSDLSPCNRHHVELAQRVKDGIRDAGGIPIEFPVHPIQETVRRPTASLDRNLAYLGLVEALYGYPFDGVVLTTGCDKTTPAMLMGAATVDIPSIVLSGGPMLNAWYKGERAGSGTIIWHARSELAAGRMDYDEFLSCVANSAPSIGHCNSMGTALSMNSLAEVLGMSLPGCGTIPAPYRERGQMAYQTGRQIVQLVHDDVRPSSLLTREAFENAIVVASAIGASTNCPPHINAIARHIGVDLDIRDWDRLGYDIPLLVNCMPAGKYLGEEFHRAGGVAAVVHELLKAGKLHGDVQTVSGKTLAQCYGDSPATDADVIRPYASPLKSEAGFAVLGGNLFDSAVMKTSVISDDFRHKYLENPADPGAFEGRAIVFEGPEDYHDRIDDPALEIDENCILFIRGTGPVGYPGAAEVVNMIPPSELIKRGVTLLPCVGDGRQSGTSASPSILNASPESAIGGGLAILQTGDRVRFDLTRRRADMLVPEDELDRRRREWKAYEFVNQTPWQELHRRYVGQLEDGACLDFSVKYQRVAEVHGVPRDNH
Hit FamilyFIG00138258
Hit Family FunctionDihydroxy-acid dehydratase (EC 4.2.1.9)


back to search