Query Sequence
>BPHYT_RS31650
MLIEAVSTDDSERLVAEVSQAQSHGTPLSIRGGNSKAFLGRPVQGTPIDTRSHRGVVSYDPTELVITARAGTPVAELAAVLDAAGQMLPCEPPEFDGTATVGGMVAAGLAGPRRPWSGSVRDFVLGCRVITGRALHLRFGGEVMKNVAGYDVSRLLAGSFGCLGLITEVSFKVLPKPRALGSLALDLEAGEALRELSAWRPAGLPISGAAHVDGRLHVRLEGGTGSVASAMDRIGGTELDPRFWDALREHRLAFFDDPRPLWRLSLPNASPLTPLPGDTLLDWAGAQRWLKSEAPATTIRQIAHAAGGHATCFTPRVDAERFSPLPPTLLRFHQRLKQQLDPRGLFNPGRLYVDL
Hit FamilyFIG00027246
Hit Family FunctionGlycolate dehydrogenase (EC 1.1.99.14), FAD-binding subunit GlcE


back to search