Query Sequence
>BPHYT_RS28515
MTFRWYGDTDPVPLAYIRQIPGMVGVVSAIYDVPVGEVWPIDRIRSLKEKIEAHGLTLEVIESVPVHEDIKLGKPTRDTLIVNYGQTLRNLGACGVKVVCYNFMPVFDWTRTSLEMPLPDGSTTLAFDTQAIRELDVSEGIQLPGWDASYRPEQLKALLRDYEALDEAGLWANLDYFLRAIIPVAKEAGIKMAIHPDDPPRPIFGLPRIVKNRADLQRVLDIVDDPANGLTLCSGSLGADLQNDIPALVREFGARGRIHFAHLRNVQTNAAGDFHETSHRSADGSLDMAEIVKAYFETGFEGYARPDHGRMIWGETGRAGYGLFDRALGAVYLNGIWEGLAKHPADHAAE
Hit FamilyFIG00060024
Hit Family FunctionMannonate dehydratase (EC 4.2.1.8)


back to search