Query Sequence
>BPHYT_RS27785
MNIKAPNPASLGLAGFALTTWLLSMINAGWFNGESMGMVLAVAFAYGGTAQMIAGLMEIPRGNAFGATAFLSYGAFWWSLALFVLFLHGNVPAAFIGWYLFLWGMFTLYMWVATWRAARALQLVFLSLWLTFFVLAASEWTGLAWLHHAGGYLGLVTALLAFYLSAAEIINETHGRVVLPVGAASPRIEVALTVDEELRRA
Hit FamilyFIG01312420
Hit Family FunctionTranscriptional regulator


back to search