Query Sequence
>BPHYT_RS26525
MNRRYWLLSATVCALATYMPFSWAADPQIVKIGFVGPLTGPVARVGKDLQYGAQLALDEENAKNPMIGGKPVKFVLDVQDDQADPRVAIQVAQKLVDDGVVGVIGHYNSGCSIPASTVYHQANVAMITPGSTNPQLTKQGFKNVFRTMGHDGIGGVVAGHFVVEQMKAKRIAIIDDRTAFGQGLADAFEKGVKEANGNIVDREFTNDKAIDFRAILTTLKSKNVDLIFFGGLDEQGAMLVKQMRSLGMSTQLFGAGALKSNAFLQIAGTAGNGTQDLEPGPALDKLPAAQAFGKRYKARFNQDVELYAPFSYDAALAMLKAIHTADSLDRAKIVDSLAKVTVTGVTGNITFDPYGDLIKPPYTLFQVEQGQWKSVKTVGGSGA
Hit FamilyFIG00002494
Hit Family FunctionLeucine-, isoleucine-, valine-, threonine-, and alanine-binding protein


back to search