Query Sequence
>BPHYT_RS25100
MNVSVFDLFKIGIGPSSSHTVGPMIAACRFASHIEDANLLGFVRGVKVDLFGSLGATGKGHGTDKAVLLGLEGNLPDSIDPDLIEPRLQAIRVTKQLVLLGKHPVKFDEREHLGFFRKLMPGAPGSGIVHPNGMRFQAFDENGQLLVEKEYYSVGGGFVVNREGDRVNGVRAGAEVPYPFRTGDDLMRVCRETGLSIAQITLRNECAARPEQEVREGLLAIWRTMSACVERGCKVRGELPGPMHVKRRAADLCGQLRSRSEESLRDPLSMLDWVNLYAMAVNEENAAGGRVVTAPTNGAAGVIPAVLHYYVKFMHASNDEGIVNFLLTAAAIGIIYKETASISGAEVGCQGEVGVACSMAAAALAAVMGGTPTQVENAAEIGMEHNLGMTCDPVGGLVQIPCIERNAMGAIKALNAARMAMKGDGQHYVSLDNVIKTMRETGADMKTKYKETSRGGLAVNVIEC
Hit FamilyFIG00000551
Hit Family FunctionL-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)


back to search