Query Sequence
>BPHYT_RS24045
MFSTTVFLQGLPLLLHAALATIGISLAGLLIGFFVAIGVCAARLSPNRAARMFGGAYVFFFRGVPMLVQLLLVYYLLPFAGINVSPIVAALSAVSLCSASYIAEILRGGFLSVPPGHLEAARMLGLSPFDMLRRILVPQAFRLTLPSLVNEMVLLIKASSLISVVGVAELTRTAQNIAASTYRPLEAYVAAGLIYFVICGALALVAHAAEYRLQHA
Hit FamilyFIG00050908
Hit Family FunctionGlutamate transport membrane-spanning protein


back to search