Query Sequence
>BPHYT_RS18295
MQVSTWENPLGTDGFEFIEYTAPDPKALGKLFEQMGFTAVARHRHKDVTLYRQGEINFIVNGEPDSFAQRFTRLHGPSICAIAFRVQDAAKAYKEALEKGAWGFDNKTGPMELNIPAIKGIGDSLIYFVDRWRGKNGAEPNSIGNIDIYDVDFEPIAGANPNPVGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGKIRIPINEEGSETAGQIQEYLDAYHGEGIQHIALGSNDIYRTVDGLRGSNISLLDTIDTYYELVDRRVPNHGEPLDELRKRKILIDGAPEDLLLQIFTENQIGPIFFEIIQRKGNQGFGEGNFKALFESIELDQIRRGVVQDKV
Hit FamilyFIG00001109
Hit Family Function4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)


back to search