Query Sequence
>BPHYT_RS18255
MNKEWPIWEVFVRSKQGLDHKHCGSLHAADAPMALRMARDVYTRRQEGVSIWVVPSSAITASAPEDKAELFEPAGDKIYRHPTFYTLPDEVNHM
Hit FamilyFIG00002137
Hit Family FunctionPhenylacetate-CoA oxygenase, PaaH subunit


back to search