Query Sequence
>BPHYT_RS17615
MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLLNFEKELFVHVGTLENEKGKAAEKNHEKARLAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLLWRLDHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR
Hit FamilyFIG00001437
Hit Family FunctionStringent starvation protein A


back to search