Query Sequence
>BPHYT_RS16155
MSFLGIDLGTGSLKVAIVDENGREQAVASVAYPIETPQAGWAETSVQTWWRALCEAAARLPDGLRRDVRAIGFSGQMHGVVLIDAAGEAVRPAMLWPDTRALALLEAWPEPQPNPVAPGMAGPLLRWIVLHEPQSASRTRWALQPKDWLRVALGGAVATDPSDACATALADPAGVWDAALLDRLEIPHEWFAPLAPSYAAGGVLSESAARALGLRAGIVLATGAADTPCAALGSGLAHDGDALLTTGTGGQIVVLAEHAPAAVKGLHRYRAASDHWYRMAAMQNVGIALERARGWLSYEWADAYRDAFGDATNATNATNATATFSANTAAASGLTFLPYLTGERTPWLNPMARGGWLGLALDHTRGTMMRAAFEGVAFSLRAGLDAIRASGATVTALKLAGGGSVDARWRQLLADALNVELHAVDCPNAAPRGAAILGGLASGHWHARDLAALAPGATRVAGPQGDAALAERYERFLDLYGRIETWFTDTPSQ
Hit FamilyFIG00000793
Hit Family FunctionXylulose kinase (EC 2.7.1.17)


back to search