Query Sequence
>BPHYT_RS16105
MSQVASTPVSNPTAMTVPAKSPFAAIRRGIPGVIAWLVALLLFFPIFWMTITAFKTEQQAYASSLFFIPTLDSFREVFARSNYFSFAWNSILISAGVTILCLILAVPAAYAMAFFPTRRTQKVLLWMLSTKMMPSVGVLVPIYLLWKNSGLLDSVSGLVIVYTLINLPIAVWMSFTYFAEIPRDILEAGRIDGAATWQEIVYLLMPMSLPGLASTALLLVILSWNEAFWSINLSSSNAAPLTVFIASYSSPEGLFWAKLSAASLLAVAPILIVGWLSQKQLVRGLTFGAVK
Hit FamilyFIG00008252
Hit Family FunctionVarious polyols ABC transporter, permease component 2


back to search