Query Sequence
>BPHYT_RS15730
MPYQHIKVPTGGDKITVNADFSLNVSDQPIIPYIEGDGTGLDITPVMIKVVDAAVEKAYAGKKKIHWMEIYAGEKSTKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVALRQELDLYVCLRPVQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWPAESEQAKKVIKFLREEMGVKKIRFPDTSGIGIKPVSREGTERLVRKAIQYAIDNERRSVTLVHKGNIMKFTEGAFRDYGYALAQKEFAAELIDGGPWMKIKNPKTGGDIVLKDVIADAFLQQILLRPAEYDVIATLNLNGDYVSDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHLGWTEAADLIIKSMEKSILQKRVTYDFARLMEGATQVSCSGFGQVLIENM
Hit FamilyFIG00000600
Hit Family FunctionIsocitrate dehydrogenase [NADP] (EC 1.1.1.42)


back to search