Query Sequence
>BPHYT_RS14805
MKILVPVKRVVDYNVKVRVKSDGTGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEVIAVSAGVTQSQETLRTALAIGADRAILIESSQELQPLAVAKLLKALVDKEQPSLVILGKQAIDDDSNQTGQMLAALAGLPQATFASKVVVADGKATVSREVDGGAETLSLKLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLEVLKPEDLGVDVTPRLKTLKVVEPPKRSAGVKVPDVKTLVEKLKTEAKVL
Hit FamilyFIG01304886
Hit Family FunctionElectron transfer flavoprotein, beta subunit


back to search