Query Sequence
>BPHYT_RS13920
MTAFDVRIGINPLSWMNDDLPSLGGETPLEVALTEGREIGYQGFELGNKFPREPQALKSLLAQYDLALVSGWYSGRLARRSVEEEIAEVGPHLELLAQNGATAMVYGEVADSIQGAAQPLYQRPRFFSEKQWADYAARVDEFARYTLSRGVRLAYHHHMGAYVETPADVDQLMARTSDAVGLLFDAGHITFAGGDPLAVLDKHIGRVCHVHCKDVRPAVMKLARNRNWSFLDAVIAGAFTVPGDGAVNFPAIIERLKRHGYCGWLVVEAEQDPVVAPSFEYAQKGYKTLRALVDAPLDGTEQEAA
Hit FamilyFIG00001357
Hit Family FunctionInosose dehydratase (EC 4.2.1.44)


back to search