Query Sequence
>BPHYT_RS13905
MILALENVNKYFGKVIALSGVTLRLKRGEVHCLLGDNGAGKSTLIKTLAGVHQPSSGQYLVDGKPVLFESPKDALDLGIATVYQDLALVPLLSVARNFFMGREPQKKLFGFLSVMDLETSATTARDKLAEMGINVRDAHQPIGTMSGGEKQCLAIARAIHFGARVLILDEPTAALGVKQSFNVLKLIHKARAKGISVIFITHNVHHAYPIGDSFTVLNRGKSLGTFTKETISKDEVLDMMAGGAEMQKMIGELEGATI
Hit FamilyFIG00008439
Hit Family FunctionInositol transport system ATP-binding protein


back to search