Query Sequence
>BPHYT_RS13895
MRLCKGKATLRILVTALTLATGFGAASAARAADAHFVLISHAPDSDSWWNTIKNAIKQADEDFNVETDYRNPPNGDIADMARLVEQAAARNYDGVIVTIADFDVLKSSINKVTAKKIPLVTINSGTEEQSAQLGAIMHVGQPEYVAGKAAGEKAKAAGVKSFLCVNHLATNTVSFDRCRGFAEAIGVDYKSSTIDSGQDPTEIQSKVSAYLRNHPNTGAILTLGPTPASATLKAVQQMGLAGKIYFCTFDFSDDIAKAIQNGTIQFAIDQQPYLQGYIPVAVLAIVKKEHTTDPAKIRQILEANPKFKERLATYGLAPSYGPKNIRSGPGFITKENLDKVIKYAGQYR
Hit FamilyFIG00008311
Hit Family FunctionInositol transport system sugar-binding protein


back to search