Query Sequence
>BPHYT_RS13750
MTQTAFLAACRDAIGAAQVLTDPHDTALYLTDWRRRYAGAACAVLCPATPDEVAALVKLAVEHRIALVPQGGNTGLAGGATPDASGAQAVISLRRLNRVRDIDPHNNTITVEAGVILAEVQKHADEAGRLFPLSLAAEGSCTIGGNLATNAGGTGVLRYGNARELCLGLEVVTPQGELWDGLRGLRKDNTGYDLRDLFIGAEGTLGIITAAVLKLHPRPAARVTALAALASPHAALDFLSLTQRVAGPLLTGFELMSDFCLRLVGRHFEQMRYPFAEPHAQVVLLELSDSESEEHARELFERLMETALESGLVQDAVVAENLSQSRAFWNLREHIPLAQAEEGLNIKHDIAVPISRVGHFIEETDAAIAQAVPGARMVTFGHLGDGNLHYNVQAPEGVDAKAFLTQYQSPINQIVYDSVHRHRGSISAEHGLGQLKIDEAMHYKQDVEVQLMRAVKRALDPLNLMNPGKVLR
Hit FamilyFIG00005482
Hit Family FunctionD-2-hydroxyglutarate dehydrogenase


back to search