Query Sequence
>BPHYT_RS13550
MDLNFTPEEEAFRADVQAFLRDKLPQRLADKVHGGRRLTRDDMAEWHAILNAQGWLANHWPKEYGGPGWNPVQKFIFENECALAGAPRVVPFGVNMLGPVLIKYGSEAQKRHWLPRILDGSDWWCQGYSEPGAGSDLASVKTTAVRGVDAQGEHYLVNGQKTWTTLGHFANMIFCLVRSATDVRKQEGISFLLIDMKTPGVEVRPIITLDGEHEVNEVFFTDVRVPVENLVGEENKGWTCAKYLLTYERTNIAGVGFSVAAFNRLRKIAAKQRRNGRPLAEDPAFAARMARVEIDLENMKTTNLRVIAAVAGGGVPGAESSMLKIRGTEIRQEISSLTRRAMGAYAQPFIEEALHDGFEGTPVGPDEAASAASLYFNNRKLSIFGGSNEIQKNIISKMILGL
Hit FamilyFIG01963292
Hit Family FunctionAcyl-CoA dehydrogenase, long-chain specific, mitochondrial precursor (EC 1.3.99.13)


back to search