Query Sequence
>BPHYT_RS11220
MSQRIRRRILTAAVLATATAALPLSSAYAQSAPAHKPKVALVMKSLANEFFLTMETGAKDYQKHNPSQFDLITNGIKDETDTANQIRIVEQMIVSKVDAIVLAPADSKALVPVVKKAVDAGIIVVNIDNRLDPEVLKSKDLNVPFVGPDNRKGAQKVGDYLAKKLKAGDEVGIIEGVSTTTNAQQRTAGFKDAMQKVGAKVVSVQSGEWEIDKGNAVASAMLNEYPNLKALLAGNDNMAIGAVSAVRAAGKQGKVLVVGYDNINAIKPMLKDGRVLATADQYAAKQAVFGIDTALKALSGHKKQAELSGVVETPCDLVTK
Hit FamilyFIG01962537
Hit Family FunctionRibose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)


back to search