Query Sequence
>BPHYT_RS10830
MKPAPFDYLRAMTTQHALDALAQSGEDARVLAGGQSLMAVLNMRLAQPRVLIDISRTDELGSVRVDHKAGLLTVGAAATQGNVEWRETLRDEVPLLAMAFPHISHFQIRNRGTVCGSVAHADPSAELPLVLAALGGDVMLRSRKKHRVLPAGEFFQGMLMTAREPDELVEAVRFPLKRPGERYGFTEFSARHGDFAMVACAAVVTSDSIRLAVGGVADRPVVEQWPRLRDEDLRGALNDLSWKLGAQDDAHISAAYRRHLVRQLGWRVIEEAK
Hit FamilyFIG00513859
Hit Family FunctionCarbon monoxide dehydrogenase medium chain (EC 1.2.99.2)


back to search