Query Sequence
>BPHYT_RS10825
MHVMRQGERQCVTLTLNGRERSGYCEPRELLSDFIRQELGATGTHVGCEHGVCGACTVHVDGVAGRSCLMLAVQADGRRIDTVEGLAPDMQLGDLQQAFQRHHALQCGFCTAGILMSCADYLQRVPDPSEAQVRDMLSGHLCRCTGYTPIVAAVLDVAARRRQGEAASETVEAAHA
Hit FamilyFIG00149566
Hit Family FunctionXanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4)


back to search