Query Sequence
>BPHYT_RS07675
MFLYGFGPVLLAGTIQTIELSVLSLAAAVLLGLAGAAAKLSFNRPLRAIATGYTTLIRSVPDLVLMLLLFYSIQIAVNNLTDALNLPQFDIDPFVAGVLTLGFIYGAYFTETFRGAFLAVPRGQLEAGSAYGMSGARVFTRILFPQMMRFALPGIGNNWQVLVKATALVSIIGLADVVKAAQDAGKSTFNMFFFILVAALIYLAITTASNLVLIWLEKRYSIGVRHAEL
Hit FamilyFIG00132943
Hit Family FunctionHistidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)


back to search