Query Sequence
>BPHYT_RS03800
MEPGYQSGFANEFATEALPGALPQGRNSPQRAAYGLYAEQLSGTAFTAPRGHNRRSWLYRIRPAAVHMPFTPLPSERLVANFAEVPPTPPNQLRWDALPMPAEPTDFIDGWVTMAGNGAAESMTGCAIHVYAANRSMQDRFFYTADGELLIVPQEGRLHIATEFGKLDVGPFEIAVIPRGVRFAVSLPDGVARGYICENFGALLRLPDLGPIGSNGLANPRDFLTPHAAYEDREGDFELVAKMNGNLWRADIGHSPLDVVAWHGNYAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSQTDTPGVDSIDFVIFPPRWLAAEDTFRPPWFHRNVASEFMGLVHGVYDAKAEGFVPGGASLHNCMSGHGPDAETFEKASHSDTSTPKKVGDTMAFMFETRTLIKPTRFALETAQLQAHYYECWQGLTKHFNPEQR
Hit FamilyFIG00001172
Hit Family FunctionHomogentisate 1,2-dioxygenase (EC 1.13.11.5)


back to search