Query Sequence
>BPHYT_RS02830
MSRYWSDIVHRLTPYVPGEQPVVAHPVKLNTNENPYPPSPRVLEAIRQELGDAADSLRRYPDPTAQKLRETVAAYHGIRAEQVFAGNGSDEVLALTFQALLKHDKPLLFPDITYSFYPTYARLFEVDYRTVPLDDSFAINVDDYKSPNGGILFPNPNAPTGRPLPLADIERLVASNPDSVVVIDEAYVDFGAESAICLIDRYPNLLVVQTVSKSRSLAGMRVGFAFGNRELIGALNRVKDSFNSYPLDRLAQVAAAAAYEDDAWFRDTCAKVMASRERLAAGLTALGFEVVPSAANLLFARHEGYDAATLVLRLREKEIFVRHFKAPRIDQHLRISVGTDAECDVLLDALREIFSAYVG
Hit FamilyFIG00027527
Hit Family FunctionHistidinol-phosphate aminotransferase (EC 2.6.1.9) @ Aromatic-amino-acid aminotransferase (EC 2.6.1.57)


back to search