Query Sequence
>BPHYT_RS02335
MKLATLKDGTRDGQLIVVSRDLHTAAVADAIAPTLQRVLDDWAFYAPQLHDLYDALNQGRARNTFPFDAKECMAPLPRAFQWADGSSYVNHVELVRRARGAEMPPEFWTDPLMYQGGSDDFIGPKDDVLCASEAFGIDFEAEVAVITGDVPMGVTPDQALRSVRLITLVNDVSLRNLIPADLAKGFGFFQSKPATSFAPMAVTPDELGEHWREGRVHRPMIVHWNNKKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGAIVGSGTVSNKDAKRGYCCIAEKRCLETIEHGAPQTEFMKYGDTVKIEMFDEAGKSIFGSIDQGIAPLD
Hit FamilyFIG00007658
Hit Family FunctionFumarylacetoacetate hydrolase family protein


back to search