Query Sequence
>BPHYT_RS01960
MRGVASVISALMFGALAGAVVPVARAADAPRGQLVANANACMGCHAVDRKLVGPSFQQIAGKYKGDAQAPAKLSRKVKDGGSGVWGMIPMPAHQSMSDADIRAVVDWVLAGAPSR
Hit FamilyFIG00066414
Hit Family FunctionCytochrome c551/c552


back to search