Query Sequence
>BPHYT_RS01825
MASLNTQSRRHVRKQQIRPLAGSLLALAIGFGVATAHADDALPKLASKTPLKVGFAQTESNNPWRLAETKSFKDIAAKCGWQLVMTDANSSNSKQVSDIQNMIAQHVDLLVFPPREEKPLAPVVLQAKKAGIPVILVDRDVDQSVAKAGRDYITFIGSDFIDQGHRAADWLVKATGGKAKIIELEGTTGASAANDRKKGFDEIIAKNPGMTIIASQSGDFARDKGRQVMETLLQAHPDVTAVYAHNDEMALGAIAAIKAAGKQPGKDIQIVTIDGTKGGMDAIAAGELGASVQSSPFFGPLACDVAQRYAKGEKIPTWVKVSDKFYDKSNVQQNMQYGY
Hit FamilyFIG00008285
Hit Family FunctionRibose ABC transporter, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)


back to search