Query Sequence
>Ac3H11_601
MNPIDKALFHILQRCGLIAILRGVQPHEVVAIGHALYDAGFRIIEVPLNSPEPLASIRALRDALPADCLVGAGTVLSIDAVADVAAAGGQIIVMPHSDPDVIRAARAAGMACAPGVATLTEAYAALAAGANMLKLFPAEALPPHVLKAWRAVITPPMALVPVGGIVPESIAPYAAAGASGFGLGSALYRPGDQAPEVAHKAAAFARAWQASFGTAPATT
Hit FamilyFIG00065872
Hit Family Function2-dehydro-3-deoxyphosphogalactonate aldolase (EC 4.1.2.21)


back to search