Query Sequence
>Ac3H11_4758
MPVNLVAPVAADLYPIAGVRIGVAEAGVRKANRKDLTVFLLDEGASVAGVFTQNRFCAAPVQISREHLSQQQAGQPIRAMVINTGNANAGTGADGLARARSTCVALARQLSVAPEQILPFSTGVIMEPLPNDRIEAGLPAAIADAQPGHWARAAEGIMTTDTLPKAFSAQAQIGGATVSITGISKGAGMIRPNMATMLGFLATDACVAPAVMQQLARELADGSFNRVTIDGDTSTNDSFVVVATNKAAHAPITSLDSAEGQALKAAMLAVSQKLAQAIVRDGEGATKFITVRVEGGKTGDECRKVAYAIAHSPLVKTAFFASDPNLGRILAAVGYAGIDDLDQTGIDLYLDDVHVAVQGGRNPAYREEDGQRVMKQAEITVRVLLGRGNAADTVWTCDFSHEYVTINADYRS
Hit FamilyFIG00000630
Hit Family FunctionGlutamate N-acetyltransferase (EC 2.3.1.35) / N-acetylglutamate synthase (EC 2.3.1.1)


back to search