Query Sequence
>Ac3H11_4658
MTIQTVGIIGAGTMGNGIAQACAVSGINVVMVDISDAAVQKGLATVAGSLDRLIKKEKISEADKAAALARIQTSTRYDDLKAAQLVIEAATENYELKLKILKQVDAIVAPEVLIASNTSSISITKLAAATSRADRFIGMHFFNPVPMMALVEIIRGLQTSDATHDAVKALAEALGKSPITVKNAPGFVVNRILVPMINEAFFVLAEGLATPEDIDAGMKLGCNQPIGPLALADMIGLDVCLAVMDVYLTEFGDSKYRPCPLLKEMVAAGRLGRKTGQGVYSY
Hit FamilyFIG00068115
Hit Family Function3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)


back to search