Query Sequence
>Ac3H11_2705
MSVLVIAEHDNASIKGATLNTVAAAAACGGDVHVLVAGHNAGAAAAAAAQIAGVAKVIHADAAGLEHGLAENVAAQVLAIAGNYSHILFPATAGGKNVAPRVAAKLDVAQISDITKVVGADTFERPIYAGNAIATVQSGDAVKVITVRTTGFDAAPATGGSAPVEAAAAVADAGKSSFVGREVTKNDRPELTAAKIIVSGGRALGSAEKFTEVMTPLADKLGAAIGASRAAVDAGYAPNDLQVGQTGKIVAPQLYIAAGISGAIQHLAGMKDSKVIVAINKDPEAPIFSVADYGLEADLFTAVPELVKAIS
Hit FamilyFIG00136866
Hit Family FunctionElectron transfer flavoprotein, alpha subunit


back to search