Query Sequence
>Ac3H11_198
MHDTSASPSSPRLPLEGLRVVEFTHMVMGPTCGMVLADLGAEVIKVEPVDGDRTRHLLGAGAGFFPMFNRNKKSIALDLRSPEGLAAARKLAASADVVAQNFKPGVMTKYGLDYAALSQINPRLIYVNHTGFLPGPYEHRTALDEVVQMMGGLAYMTGRPGDPLRAGSSVNDIMGGMFGAIGAMAALMQRGITGRGQEVDSALFENNVFLVGQHMMQYAVTGKPAAPMPDRISSWAVYDVFSVKDGGQIFLAAVSDAQWQTFCDAMGYADLKADTSLATNNDRVRARPTLMPVLRERLAQHTADELAAVFERHGLPFAPIRRPEELFDDPHLQATGGLADITLPDGERAGQTAQITLLPLRLDGQRLDVRCDPPRLGQHTAELLQGLGYTADEVAALHAAGTIA
Hit FamilyFIG00000963
Hit Family FunctionHydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)


back to search