Query Sequence
>AZOBR_RS31940
IHPGSGRRNTRPQPKGRQVDPAALAEVQELLGDRSRQRDLLIEHLHLLQDTYHGLHARHLAALAHEMRLALVEVYEVASFYAHFDIVMDGEEAPPPVTVRVCDSLSCCMAGGEKLLDELKAADMGPDVRVVRAPCMGACHNAPAVAIGHALHENATVESVVTAVKNGETHPQLPTYVSLEQYKAEGGYRLLADCLTGNVPVDDILGKLEGANLRGLGGAGFPTGRKWRFVRHEPGPRLMAVNGDEGEPGTFKDRYYLENDPHRFLEGMLIGAWVVEATDVYIYLRDEYPHIREVLEHEIAAVEKAGLAGHTRIHLRRGAGAYICGEESAMLESIEGKRGLPRHKPPFPSVVGLFGRPTLINNVETLFWIRDILEKGADWWGSHGRNGRKGLRSYSVSGHVKDPGVKLAPAGVTIRELIDEYCGGMADGHTLKGYLPGGASGGILPASMDDIPLDFGTLEQHGCFIGSAAVVVLSDQDDMRKVVRNLLDFFEDESCGQCTPCRVGTEKAVALIKQPVWDEPLLTELARLMGTASICGLGQAAMNPLKSALKHFRDDLRGEVR
Hit FamilyFIG00006558
Hit Family Functiontungsten-containing formate dehydrogenase beta subunit


back to search