Query Sequence
>AZOBR_RS31445
MSLGNPAKGMLAAAVLAAAALFAAPASAEIKNLEIIAPANAGGGYDQHARAMQQVLQEHKLASSVQVVNIPGAGGTIGLSQFVTAKKRNPGLMISGLGMIGAILINKSPVSLDQVTPLARLTGEYQPIVVAADSPLKTLDDLVKKFKADPGSVSWGGFAVGSPDHILYGLLVKAIGGDVSKMNYIAAGAGGEMMASVLGGHITVATGGYNEMASQLQAGKLRALAISAPQRLPGIDVPTFKEQGVDVELVNWRAVMAPGNLKASEKQVLDDAVGAMVRTDEWKRIAEERGWIDLYLPPDRFAAFVKDERTRIEGVLMELGLVK
Hit FamilyFIG00050854
Hit Family FunctionTricarboxylate transport protein TctC


back to search