Query Sequence
>AZOBR_RS31375
MRLSPDTLPSLRHGAQRPGYDRAALTTGIVHLGIGAFHRAHQAVYTDDALARSFGPWGIAGVSLRSPDTRDALEPQGGLYTVAVRDAAGERLRVIGSVTQLLVAPEDPAAVLDLLTRPSVRIVTLTVTEKGYCHDPATGALNEAHPDIVHDLANPESPRSVPGFLVEALIRRRAAGVEPFTVLSCDNLPSNGDTAAGLLRRYAELRDPALGTWFAGNVACPNSMVDRIVPATTDADRDRVSDGLGLRDSWPVVTEPFSQWVIEDRFPTGRPAWELEGAELVPDVHPYETMKLRLLNGSHSTLAYLGYLAGYETVSDTMADPAFARLIRGLMDEEAGPTLHMPPGADLGHYKDALIERFRNPALRHRTWQIAMDGTQKLPQRLLGTIRDRLAAGAPIDRLALGVAAWMRYVSGTDEAGRPIDVRDPMAARLAELAAEAGPDADRLATALFGLTAVFGDDLPRDPRFTAAVTDALRRLYAEGARAVVQSVAPAAG
Hit FamilyFIG00001516
Hit Family FunctionD-mannonate oxidoreductase (EC 1.1.1.57)


back to search