Query Sequence
>AZOBR_RS30770
MRLTLFQTDAEPGAPHRNLDRLERAAAEAAERGPALLVGPEMGLTSYDIGAETVRALAEPVDGPMAARVAEIARRHGIAILYGYPERGADGAVYNAAQLIGSDGQSLLNQRKTHLYGDLDRGSFAPGGDAFPTAEVDGMRVGVAICYDVEFPELVRRHALAGVDVLLVPTALMTPYEIVATTVIPARAFENGIFVAYANRCGREGTLRYCGLSSVAAPDGSVLARAGDGEALLTVDLDAALRRVGTHLADRRPDLYGAVSSTPGKGGS
Hit FamilyFIG00138820
Hit Family Function5-aminopentanamidase (EC 3.5.1.30)


back to search