Query Sequence
>AZOBR_RS29735
MSILVIAEHDNAALKAATLNAVSAAAKIGGDIHVLVAGQGAQAVAEAAATVAGVAKVLLADDAAYAHPLPENVAPLVVNLAKGYGHVLAAASSEGKNLLPRVAALLDVAAISDITGVVSADTFERPIYAGNAIATVKSADPIKVVTVRTTAFEAAAATGGSATVESIAGTGDAGSARFVGQELTKSERPELTQAKIVVSGGRGMQSGENFKLLEALADKLGAAVGASRAAVDAGFVPNDYQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADYGLVADLFKAVPELEQAL
Hit FamilyFIG00136866
Hit Family FunctionElectron transfer flavoprotein, alpha subunit


back to search