Query Sequence
>AZOBR_RS29205
MQDFSFPAPPTAPDTAELRAEVRAFLAAELAGYPAAKRIRSWSGFDAEFSRKLGQRGWIGMAWPKQYGGHERSALERYVVLEELLAAGAPVAAHWIADRQSGPLLLKVGTEEQKRSILPRIAAGEFFFCIGMSEPDSGSDLAAVRTRAVPVEGGWRVNGTKLWTTYAHHAHAMILYCRTGAADDRHGGTSQFLVDLTLPGITIRPIADLSGARHFNEVVFEDVLLPHSALIGQEGDGWNQVMSELAYERSGPERFMSTFVLFVELVRALGSQMTPDAAGALGRLGVHLVVLRRLSRSVAGMLQDGRNPALQASVVKDLGALVEQEIPEIARQLMAMEPDLRSHDALSAVLGYSILNAPAFSLRGGTREILRGIIARGLGLR
Hit FamilyNo hits found for this sequence


back to search