Query Sequence
>AZOBR_RS22310
MLSNQYPTLNFDLGESADMLRDTVRSFAADEIAPRAAEIDRTNEFPNELWRKFGDLGVLGITAEEEYGGAGMGYLEHVVAMEEISRASASVGLSYGAHSNLCVNQIRKNGTAEQKTRYLPKLISGEHIGALAMSEPNAGSDVVSMKLRAEKQGDRYVLNGTKMWITNGPDADTLVVYAKTDVNAGPRGITAFLIEKSFKGFSVAQKLDKLGMRGSNTGELVFEDCEVPEENILGGVGRGVNVLMSGLDYERAVLAGGPLGIMQACMDVVVPYLHDRKQFGQPIGEFQLMQGKLADMYTIMNAAKAYVYAVAKACDRGETARKDAAGAILFAAEKATWMALEAIQTLGGNGYINEYPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFKETA
Hit FamilyFIG00138712
Hit Family FunctionIsovaleryl-CoA dehydrogenase (EC 1.3.8.4)


back to search