Query Sequence
>AZOBR_RS19250
MQTIIVPVTPFQQNCTVLWCPETMKGAAVDPGGDLPRVLRAAQSKGVTLEKILVTHGHIDHAGAVADLADELKLPIEGPHREDQFWIDGMPMQSQMFGFPPVRSFTPDRWLEEGDTVTVGNLTLDVHHCPGHTPGHVVFVHKPSKIAIVGDVLFQGSIGRTDFPKGNHGDLIESIRSKLFPLGDDVTFIPGHGPTSTIGEERLYNPFLND
Hit FamilyFIG00146515
Hit Family FunctionHypothetical metal-binding enzyme, YcbL homolog


back to search