Query Sequence
>AZOBR_RS18070
MTYRFDYSWIAEYWPVILKGLVTTVELTLIGTLFGVALGIACAWTRSLGPRWLRPPVVAYVELIRNTPFLIQLFFIFFGLPSLGVQMTEFQAAVLAMVINLGAYSGEIIRAGIEATPRGQFEAGASLAMTRFETFRHVVLIPSLQRIWPALSSQIVIVMLGSAVVSQIAAEDITFAANFIQSRTFRAFESYFLTTGLYLLLALALRQALRGVGKMLFPRRAAR
Hit FamilyFIG00895977
Hit Family Functionamino acid ABC transporter, permease protein


back to search